PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G0666
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 262aa    MW: 30284.9 Da    PI: 6.887
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G0666genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-171764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEd ll++++ ++G g+W++ a++ g++Rt+k+c++rw++yl
      Gh_D07G0666 17 RGTWSAEEDSLLIHYIGRHGEGHWNLLAKRAGLRRTGKSCRLRWLNYL 64
                     89********************************************97 PP

2Myb_DNA-binding48.61.9e-1571113246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g+ T++E+ l+++++ ++G++ W++Ia++++ gRt++++k++w++
      Gh_D07G0666  71 GNLTPQEECLILQLHSKWGNR-WSKIAKYLP-GRTDNEIKNYWRT 113
                      678******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4651264IPR017930Myb domain
SuperFamilySSF466892.02E-2915111IPR009057Homeodomain-like
SMARTSM007172.1E-141666IPR001005SANT/Myb domain
PfamPF002492.7E-161764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-211871IPR009057Homeodomain-like
CDDcd001672.34E-111964No hitNo description
PROSITE patternPS0017503241IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129422.89765119IPR017930Myb domain
SMARTSM007172.7E-1569117IPR001005SANT/Myb domain
PfamPF002491.6E-1471113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-2272117IPR009057Homeodomain-like
CDDcd001672.83E-1274113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MLSYTNSSKG DAEQLRRGTW SAEEDSLLIH YIGRHGEGHW NLLAKRAGLR RTGKSCRLRW  60
LNYLKSDVKH GNLTPQEECL ILQLHSKWGN RWSKIAKYLP GRTDNEIKNY WRTRVNKHAR  120
HLKIDANSTP FQHVIRCCNW MPRLLPEMES LNQTSQHDQE LMTMEQVPVQ EQISGSTDIM  180
STISQVAEYQ TSPFSIISNN DDYALAKNCY HDDNIDKNCC YYNLASTSAF EDFPYLVGDC  240
HKPDYNCVND GFADGLWSMG EQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-23151175106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012470048.10.0PREDICTED: transcription factor MYB108-like
TrEMBLA0A0D2N6N10.0A0A0D2N6N1_G
STRINGVIT_17s0000g03560.t011e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2236045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.13e-68myb domain protein 62